PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G352400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 731aa    MW: 80396.3 Da    PI: 6.0882
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G352400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.4e-2057112156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Aqcoe1G352400.1.p  57 KKRYHRHTQHQIQEMESFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 112
                        688999***********************************************999 PP

2START206.41.1e-642474691206
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        ela +a++elv++a+++ep+W +      e +n+de++++f+++ +     +++ea+r+sg+v   +++lve+l++++ qW++ +     +a
  Aqcoe1G352400.1.p 247 ELAVAAMEELVRLAQLGEPLWERGLengfETLNEDEYMRTFPRGIGprpygYRTEASRESGIVMISHMNLVEILMNVG-QWTNIFStivsRA 337
                        57899******************999*****************999********************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         tl+v+s+g      galq+m+ae+q+++plvp R+++f+Ry++++++g+w++vdvS+d+ ++     +v+R++++pSg+li++ +ng+skv
  Aqcoe1G352400.1.p 338 ITLDVLSTGvagncnGALQVMTAEYQVPTPLVPtRESLFLRYCKKHSEGVWAVVDVSIDHLRPAG---PVMRCRRRPSGCLIQEFPNGYSKV 426
                        **************************************************************975...7*********************** PP

                        EEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 165 twvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        +wveh++++++ p h+l+++l++s+l +gak+wvatl+rqce+
  Aqcoe1G352400.1.p 427 IWVEHIEVDDSRPvHNLYKQLIHSSLGFGAKKWVATLDRQCER 469
                        *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-223898IPR009057Homeodomain-like
SuperFamilySSF466894.18E-2044115IPR009057Homeodomain-like
PROSITE profilePS5007116.98954114IPR001356Homeobox domain
SMARTSM003891.2E-1955118IPR001356Homeobox domain
CDDcd000862.88E-1957115No hitNo description
PfamPF000465.8E-1857112IPR001356Homeobox domain
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.604.2E-499142IPR009057Homeodomain-like
PROSITE profilePS5084845.97238472IPR002913START domain
SuperFamilySSF559618.93E-35240471No hitNo description
CDDcd088752.27E-118242468No hitNo description
SMARTSM002343.5E-60247469IPR002913START domain
PfamPF018527.7E-55248469IPR002913START domain
Gene3DG3DSA:3.30.530.201.5E-5307461IPR023393START-like domain
SuperFamilySSF559615.13E-19489721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MFQRNVFDSH HNPLEMIPTT TEELGKIRDD DVDSKSGSEN LEGGSGDEQD PNQRPKKKRY  60
HRHTQHQIQE MESFFKECPH PDDKQRKELS RELGLEPLQV KFWFQNKRTQ MKTQQERHEN  120
SQLRAENEKL RAENMRYKEA LAGASCPTCG GPTVVDEMSF DEQNLRMENA RLREEIDRIS  180
SIAAKYVGKP MVSYPLMAPP IAPRGLDLSV GNYGMQPGLQ GGEVYGGPDL LRSVTGPSEA  240
EKPLVIELAV AAMEELVRLA QLGEPLWERG LENGFETLNE DEYMRTFPRG IGPRPYGYRT  300
EASRESGIVM ISHMNLVEIL MNVGQWTNIF STIVSRAITL DVLSTGVAGN CNGALQVMTA  360
EYQVPTPLVP TRESLFLRYC KKHSEGVWAV VDVSIDHLRP AGPVMRCRRR PSGCLIQEFP  420
NGYSKVIWVE HIEVDDSRPV HNLYKQLIHS SLGFGAKKWV ATLDRQCERL ASVLASNMPA  480
GDGGVITNNE GRRNMLKLAE RMVMSFCAGV SASTAHTWTS LTGSGGEDVR VMTRKSVDDP  540
GRPAGIVLSA ATSFWLPVVP KKLFEFLRDE HTRTEWDILS NGGVVQEMAH IANGREPGNS  600
VSLLRVNPAN SSQSNMLILQ EGSTDSAASF VVYAPVDLAA MNMVLTGGDP DYVALLPSGF  660
SILPDGQILN RGGAVDVGAS GSLLTVAFQI LVDSAPSAKL SLGSVATVNN LISCTVERIK  720
NSIAGAKHEL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657313.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X5
RefseqXP_010657315.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X5
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2